General Information

  • ID:  hor006619
  • Uniprot ID:  P0C0P6
  • Protein name:  Neuropeptide S precursor
  • Gene name:  NPS
  • Organism:  Homo sapiens (Human)
  • Family:  NA
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with NPS include Anxiety and Functional Colonic Disease.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0035249 synaptic transmission, glutamatergic; GO:0045760 positive regulation of action potential; GO:0051968 positive regulation of synaptic transmission, glutamatergic
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  YPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS
  • Length:  66
  • Propeptide:  MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS
  • Signal peptide:  MISSVKLNLILVLSLSTMHVFWC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Modulates arousal and anxiety. May play an important anorexigenic role (By similarity). Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations (PubMed:15312648, PubMed:16790440).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPSR1
  • Target Unid:  Q6W5P4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C0P6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006619_AF2.pdbhor006619_ESM.pdb

Physical Information

Mass: 864536 Formula: C338H551N93O92S3
Absent amino acids: HW Common amino acids: KS
pI: 11.1 Basic residues: 14
Polar residues: 21 Hydrophobic residues: 20
Hydrophobicity: -38.94 Boman Index: -12432
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 73.79
Instability Index: 4929.55 Extinction Coefficient cystines: 2980
Absorbance 280nm: 45.85

Literature

  • PubMed ID:  15164054
  • Title:  The DNA sequence and comparative analysis of human chromosome 10.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  15312648
  • Title:  Neuropeptide S: a neuropeptide promoting arousal and anxiolytic-like effects.
  • PubMed ID:  16790440
  • Title:  Structure-function relationships in the neuropeptide S receptor: molecular consequences of the asthma-associated mutation N107I.